Antibodies

Jump to Filters
View as table Download
MNK2 (MKNK2) Rabbit Polyclonal Antibody
TA333339

USD 375.00

5 Days

Rabbit Polyclonal Anti-MKNK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MKNK2 Antibody: synthetic peptide directed towards the N terminal of human MKNK2. Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
MKNK2 Rabbit Polyclonal Antibody
TA366124

USD 380.00

4 Weeks

MKNK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MKNK2
MKNK2 Rabbit Polyclonal Antibody
TA370477

USD 380.00

4 Weeks

MKNK2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MKNK2