Antibodies

Jump to Filters
View as table Download
SLCO1A2 Rabbit Polyclonal Antibody
TA333729

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SLCO1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLCO1A2 Antibody: synthetic peptide directed towards the middle region of human SLCO1A2. Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK