Antibodies

Jump to Filters
View as table Download
Calbindin (CALB1) Rabbit Polyclonal Antibody
TA342845

USD 375.00

5 Days

Rabbit Polyclonal Anti-CALB1 Antibody

Applications IHC, WB
Reactivities Human, Tadpole
Conjugation Unconjugated
Immunogen The immunogen for anti-CALB1 antibody: synthetic peptide directed towards the C terminal of human CALB1. Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM