Antibodies

Jump to Filters
View as table Download
AATF Rabbit Polyclonal Antibody
TA306107

USD 430.00

5 Days

Rabbit Polyclonal AATF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen AATF antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human AATF.
AATF Rabbit Polyclonal Antibody
TA329431

USD 375.00

5 Days

Rabbit Polyclonal anti-AATF antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE