Antibodies

Jump to Filters
View as table Download
TLR6 Rabbit Polyclonal Antibody
TA329400

USD 375.00

5 Days

Rabbit Polyclonal anti-TLR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT
TLR6 Rabbit Polyclonal Antibody
TA337082

USD 402.00

5 Days

Rabbit Polyclonal TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Within the range of amino acids 25-56 of human TLR6 protein were used as the immunogen.
TLR6 Rabbit Polyclonal Antibody
TA349554

USD 345.00

In Stock

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6
TLR6 Rabbit Polyclonal Antibody
TA350974

USD 345.00

In Stock

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR6