Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG |
GPR161 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey |
| Immunogen | GPR161 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human GPR161. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster (100%); Panda, Dog, Horse, Rabbit (95%); Mouse, Elephant, Bat, Pig, Opossum, Turkey, Chicken (89%). |
Germany
Japan
United Kingdom
China
