Rabbit Polyclonal Anti-POR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the N terminal of human POR. Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT |
Rabbit Polyclonal Anti-POR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the middle region of human POR. Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE |
Germany
Japan
United Kingdom
China
