Antibodies

Jump to Filters
View as table Download
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA346569

USD 475.00

5 Days

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA332939

USD 345.00

3 Weeks

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA349690

USD 345.00

In Stock

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA384312

USD 380.00

4 Weeks

Aspartate Aminotransferase Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Aspartate Aminotransferase