Antibodies

Jump to Filters
View as table Download
LEF1 Rabbit Polyclonal Antibody
TA349379

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1
LEF1 Rabbit Polyclonal Antibody
TA330286

USD 310.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ