Antibodies

Jump to Filters
View as table Download
SNAIL (SNAI1) Rabbit Polyclonal Antibody
AP20370PU-N

USD 370.00

2 Weeks

SNAIL (SNAI1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human SNAI 1 around the phosphorylation site of Serine 246.
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA349439

USD 380.00

In Stock

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA332751

USD 275.00

3 Weeks

Rabbit anti-Snail Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Snail
SNAIL (SNAI1) pSer246 Rabbit Polyclonal Antibody
AP20798PU-N

USD 370.00

2 Weeks

SNAIL (SNAI1) pSer246 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
SNAIL (SNAI1) Rabbit Polyclonal Antibody
TA333928

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL