Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide from C-terminal of human claudin 11 protein

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11