Antibodies

Jump to Filters
View as table Download
DNA Ligase IV (LIG4) Rabbit Polyclonal Antibody
AP06802PU-N

USD 370.00

2 Weeks

DNA Ligase IV (LIG4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 600-650 of Human DNA Ligase IV.
DNA Ligase IV (LIG4) Rabbit Polyclonal Antibody
TA334753

USD 310.00

5 Days

Rabbit Polyclonal Anti-LIG4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIG4 antibody: synthetic peptide directed towards the N terminal of human LIG4. Synthetic peptide located within the following region: DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ