Antibodies

Jump to Filters
View as table Download
E2F4 Rabbit Polyclonal Antibody
TA313778

USD 345.00

4 Weeks

Rabbit polyclonal anti-E2F4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human E2F4.
E2F4 Rabbit Polyclonal Antibody
TA329212

USD 375.00

5 Days

Rabbit Polyclonal anti-E2F4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4. Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
E2F4 Rabbit Polyclonal Antibody
TA350654

USD 345.00

In Stock

Rabbit Polyclonal Anti-E2F4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human E2F4