Antibodies

Jump to Filters
View as table Download
SMAD6 Rabbit Polyclonal Antibody
TA331111

USD 310.00

5 Days

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR
SMAD6 Rabbit Polyclonal Antibody
AP20668PU-N

USD 370.00

2 Weeks

SMAD6 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat