Antibodies

View as table Download

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CUL3

Rabbit Polyclonal Anti-CUL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL3 antibody: synthetic peptide directed towards the C terminal of human CUL3. Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS

Rabbit polyclonal anti-Cullin 3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Cullin 3.

Rabbit polyclonal anti-Cul3 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1-12 of Human Cul3 (N-terminus) coupled to KLH.