Antibodies

Jump to Filters
View as table Download
HMG4 (HMGB3) Rabbit Polyclonal Antibody
TA339108

USD 310.00

5 Days

Rabbit Polyclonal Anti-HMGB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3. Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE
HMG4 (HMGB3) Rabbit Polyclonal Antibody
TA322626

USD 345.00

4 Weeks

Anti-HMGB3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 164-178 amino acids of Human high mobility group box 3
HMG4 (HMGB3) Rabbit Polyclonal Antibody
TA322627

USD 345.00

In Stock

Anti-HMGB3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 164-178 amino acids of Human high mobility group box 3