Rabbit Polyclonal Anti-MBP Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV |
Myelin Basic Protein (MBP) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a region of the MBP gene product shared between the Human (NP_002376) and Mouse (NP_034907) sequences. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. |
Rabbit Polyclonal Myelin Basic Protein Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
