Antibodies

Jump to Filters
View as table Download
TBPL1 Rabbit Polyclonal Antibody
TA339104

USD 310.00

5 Days

Rabbit Polyclonal Anti-TBPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBPL1 antibody: synthetic peptide directed towards the middle region of human TBPL1. Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA
TBPL1 Rabbit Polyclonal Antibody
TA366143

USD 380.00

4 Weeks

TBPL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TBPL1
TBPL1 Rabbit Polyclonal Antibody
TA370496

USD 380.00

4 Weeks

TBPL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TBPL1