Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit polyclonal PLA2G7 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7. |
Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAFAH1B3 mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified PAFAH1B3 mouse monoclonal antibody, clone OTI5D2 (formerly 5D2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
