Antibodies

View as table Download

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PAPSS1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAPSS1

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".