Antibodies

View as table Download

Rabbit polyclonal anti-Fra-2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Fra-2.

Rabbit Polyclonal anti-FOSL2 antibody

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY

Carrier-free (BSA/glycerol-free) FOSL2 mouse monoclonal antibody,clone OTI2B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FOSL2 mouse monoclonal antibody,clone OTI2B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FOSL2 mouse monoclonal antibody,clone OTI2B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated