Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 23 of 23 results

(reset)

BMP2 Rabbit Polyclonal Antibody

TA336740

USD 424.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA326222

USD 345.00

In Stock

Rabbit polyclonal MYC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

1 / 2

2 / 2

Previous Next

BMP7 Rabbit Polyclonal Antibody

TA328272

USD 285.00

5 Days

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	CHO cells derived Recombinant Human BMP-7

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 424.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA325703

USD 345.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human C-myc

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA302042

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MYC (T58)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

1 / 2

2 / 2

Previous Next

BMP7 Rabbit Polyclonal Antibody

TA330253

USD 310.00

5 Days

Rabbit Polyclonal Anti-BMP7 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

1 / 2

2 / 2

Previous Next

BMP2 Rabbit Polyclonal Antibody

TA328271

USD 285.00

5 Days

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human BMP-2

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF500002

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

CF500003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

CF500004

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

BMP4 Rabbit Polyclonal Antibody

TA323208

USD 345.00

In Stock

Anti-BMP4 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

BMP4 Rabbit Polyclonal Antibody

TA323209

USD 345.00

4 Weeks

Anti-BMP4 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

1 / 3

2 / 3

3 / 3

Previous Next

BMP6 Rabbit Polyclonal Antibody

TA351009

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-BMP6 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human BMP6

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003S

USD 159.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BMP4 Mouse Monoclonal Antibody [Clone ID: UMAB42]

UM500038

USD 468.00

In Stock

BMP4 mouse monoclonal antibody,clone UMAB42

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

BMP4 Mouse Monoclonal Antibody [Clone ID: UMAB42]

UM500038CF

USD 528.00

In Stock

Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone UMAB42

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

BMP4 Mouse Monoclonal Antibody [Clone ID: UMAB42]

UM570038

USD 180.00

In Stock

BMP4 mouse monoclonal antibody,clone UMAB42

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 23 of 23 results