Antibodies

View as table Download

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications Phospho-specific

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A