Antibodies

Jump to Filters
View as table Download
CYBB Rabbit Polyclonal Antibody
TA349081

USD 484.00

5 Days

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.
NOX1 Rabbit Polyclonal Antibody
TA349065

USD 484.00

5 Days

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3.
CYBB Goat Polyclonal Antibody
TA305618

USD 375.00

In Stock

Goat Anti-CYBB / GP91-PHOX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2.
CYBB Rabbit Polyclonal Antibody
TA335229

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
NOX1 Rabbit Polyclonal Antibody
TA351455

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-NOX1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NOX1
CYBB Rabbit Polyclonal Antibody
TA351456

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB