Antibodies

Jump to Filters
View as table Download
CLCN3 Rabbit Polyclonal Antibody
TA338775

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLCN3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCN3 antibody: synthetic peptide is 86% homologous to the C terminal of human CLCN3.. Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL