Rabbit Polyclonal anti-SUPT3H antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT3H antibody: synthetic peptide directed towards the N terminal of human SUPT3H. Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI |
SUPT3H mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SUPT3H mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
