Antibodies

Jump to Filters
View as table Download
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA329638

USD 310.00

5 Days

Rabbit Polyclonal anti-GAS7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA323843

USD 345.00

In Stock

Anti-GAS7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 184-382 amino acids of human growth arrest-specific 7