Antibodies

Jump to Filters
View as table Download
TAF5L Rabbit Polyclonal Antibody
TA330610

USD 310.00

5 Days

Rabbit Polyclonal Anti-TAF5L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the N terminal of human TAF5L. Synthetic peptide located within the following region: LTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQN