Antibodies

Jump to Filters
View as table Download
Aminoadipate aminotransferase (AADAT) Rabbit Polyclonal Antibody
TA331923

USD 310.00

5 Days

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI
AASDHPPT Rabbit Polyclonal Antibody
TA322349

USD 345.00

In Stock

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
AASDHPPT Rabbit Polyclonal Antibody
TA322350

USD 345.00

In Stock

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein