Antibodies

View as table Download

Rabbit Polyclonal anti-PLOD2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLOD2 antibody: synthetic peptide directed towards the middle region of human PLOD2. Synthetic peptide located within the following region: IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM

Carrier-free (BSA/glycerol-free) PLOD2 mouse monoclonal antibody, clone OTI6D1 (formerly 6D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLOD2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PLOD2 mouse monoclonal antibody, clone OTI6D1 (formerly 6D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PLOD2 mouse monoclonal antibody, clone OTI6D1 (formerly 6D1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PLOD2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PLOD2 mouse monoclonal antibody, clone OTI7G5 (formerly 7G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".