Antibodies

Jump to Filters
View as table Download
LAPTM4B Rabbit Polyclonal Antibody
TA342374

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAPTM4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B. Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS