Antibodies

Jump to Filters
View as table Download
Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA308146

USD 415.00

In Stock

Rabbit Polyclonal antibody to Calcium binding protein P22

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 47 and 141 of Calcium binding protein P22 (Uniprot ID#Q99653)
Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA340165

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF810226

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CHP mouse monoclonal antibody,clone OTI4B9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]
TA810154S

USD 159.00

2 Days

CHP mouse monoclonal antibody,clone OTI3H3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI1D11]
TA810172S

USD 159.00

2 Days

CHP1 mouse monoclonal antibody,clone OTI1D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI4B9]
TA810226S

USD 159.00

2 Days

CHP mouse monoclonal antibody,clone OTI4B9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".