Antibodies

View as table Download

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA

Carrier-free (BSA/glycerol-free) HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated