Antibodies

View as table Download

Rabbit anti-SHMT2 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SHMT2

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".