Antibodies

Jump to Filters
View as table Download
FABP4 Rabbit Polyclonal Antibody
TA334715

USD 375.00

5 Days

Rabbit Polyclonal Anti-FABP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
FABP4 Rabbit Polyclonal Antibody
TA321346

USD 345.00

4 Weeks

Anti-FABP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein