Antibodies

Jump to Filters
View as table Download
CTP synthase (CTPS1) Rabbit Polyclonal Antibody
TA590834

USD 409.00

In Stock

Rabbit Polyclonal CTP synthase Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CTP synthase (CTPS1) Rabbit Polyclonal Antibody
TA339249

USD 310.00

5 Days

Rabbit Polyclonal Anti-CTPS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTPS antibody: synthetic peptide directed towards the N terminal of human CTPS. Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR