Antibodies

Jump to Filters
View as table Download
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA345790

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1. Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA345791

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the C terminal of human HNRPA1. Synthetic peptide located within the following region: NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA314018

USD 345.00

4 Weeks

Rabbit polyclonal anti-hnRNP A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from inetrnal of human hnRNP A1.