Antibodies

Jump to Filters
View as table Download
YES1 Rabbit Polyclonal Antibody
TA590206

USD 409.00

In Stock

Rabbit Polyclonal Yes1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
YES1 Rabbit Polyclonal Antibody
TA358529

USD 360.00

5 Days

YES1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA