Antibodies

Jump to Filters
View as table Download
WWP1 Rabbit Polyclonal Antibody
TA329805

USD 375.00

5 Days

Rabbit Polyclonal Anti-WWP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT