Antibodies

Jump to Filters
View as table Download
Vegfa Rabbit Polyclonal Antibody
TA328561

USD 285.00

2 Weeks

Anti-Murine VEGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine VEGF
RAB22A Rabbit Polyclonal Antibody
TA344771

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAB22A Antibody - middle region

Applications IHC, WB
Reactivities Human, Murine
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
Retnla Rabbit Polyclonal Antibody
TA328551

USD 285.00

5 Days

Anti-Murine RELMa Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMα
Lep Rabbit Polyclonal Antibody
TA328529

USD 285.00

5 Days

Anti-Murine Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine Leptin
Retnlb Rabbit Polyclonal Antibody
TA328553

USD 285.00

5 Days

Anti-Murine RELMβ Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine RELMβ
RAB14 Rabbit Polyclonal Antibody
TA330015

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAB14 Antibody

Applications IHC, WB
Reactivities Human, Murin
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14. Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG