Antibodies

Jump to Filters
View as table Download
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA334203

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA351083

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11
CLDN11 Rabbit Polyclonal Antibody
TA367014

USD 380.00

4 Weeks

CLDN11 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11
Oligodendrocyte Specific Protein (CLDN11) Rabbit Polyclonal Antibody
TA374844

USD 220.00

3 Weeks

CLDN11 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2).
Modifications Unmodified