Antibodies

Jump to Filters
View as table Download
ARID5A Rabbit Polyclonal Antibody
TA339850

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARID5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARID5A antibody: synthetic peptide directed towards the C terminal of human ARID5A. Synthetic peptide located within the following region: MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL