Antibodies

View as table Download

Rabbit Polyclonal Anti-CHST4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST4 antibody: synthetic peptide directed towards the middle region of human CHST4. Synthetic peptide located within the following region: CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVR

CHST4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHST4