Antibodies

Jump to Filters
View as table Download
RGS6 Rabbit Polyclonal Antibody
TA334727

USD 375.00

5 Days

Rabbit Polyclonal Anti-RGS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RGS6 antibody: synthetic peptide directed towards the C terminal of human RGS6. Synthetic peptide located within the following region: SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY
RGS6 Rabbit Polyclonal Antibody
TA364969

USD 380.00

4 Weeks

RGS6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RGS6
RGS6 Rabbit Polyclonal Antibody
TA369313

USD 380.00

4 Weeks

RGS6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RGS6