Antibodies

Jump to Filters
View as table Download
Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody
TA345193

USD 475.00

5 Days

Rabbit Polyclonal Anti-SUFU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody
TA324037

USD 345.00

In Stock

Anti-SUFU Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human suppressor of fused homolog (Drosophila)
Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody
TA382183

USD 220.00

3 Weeks

SUFU Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 325-484 of human SUFU (NP_057253.2).
Modifications Unmodified