Antibodies

Jump to Filters
View as table Download
HEXB Rabbit Polyclonal Antibody
TA314004

USD 345.00

4 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.
HEXA Rabbit Polyclonal Antibody
TA343107

USD 375.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
A4GALT Rabbit Polyclonal Antibody
TA350957

USD 345.00

In Stock

Rabbit Polyclonal Anti-A4GALT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA351200

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT1