Antibodies

Jump to Filters
View as table Download
Doublecortin (DCX) Rabbit Polyclonal Antibody
TA346007

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-DCX Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR