Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the C terminal of human CARS. Synthetic peptide located within the following region: KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY |
Rabbit polyclonal RARS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RARS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human RARS. |
Rabbit Polyclonal Anti-TARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARS antibody: synthetic peptide directed towards the N terminal of human TARS. Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
EARS2 mouse monoclonal antibody,clone OTI2C1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
