Antibodies

Jump to Filters
View as table Download
EVI1 (MECOM) Rabbit Polyclonal Antibody
TA329377

USD 375.00

5 Days

Rabbit Polyclonal anti-EVI1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1. Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML