Antibodies

View as table Download

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

Rabbit Polyclonal Anti-HEXA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-A4GALT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT

Rabbit Polyclonal Anti-FUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT1

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NAGA mouse monoclonal antibody,clone OTI3A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated